McDonnell Genome Institute

Washington University

CircRNA

chr5|2747540|2749787|-|IRX2|ENST00000382611.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9309

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

APAPQEGEQDDLGPEK

Amino Acids from 5' Exons

MPARAAPWLAGASSPTYRRAEHSNA,CQRGLHRGWRGRPALPIEGPSTAMQ,ASEGCTVVGGGVQPYLKGRAQQC

Amino Acids from 3' Exons

GAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDE,AHPTTRTPPAPAPSATTRTAARPTRTSSTTPRTARTPRGTPRPLSRPGSTSTARTPTPPRARRSCPSSPRPSPRSPPGSPTRAGASRRRTRPGPRETKAKMRTRTRATLPEARTRVPTRRRRARRPRQRTK,RTLRRAHHRHDRRHQLPPVRQRGLPVPAQRPRVPQERHAGRHGHSQGLAQRAPQEPLPHQGREDHASHHHQDDPHPGLHLVRQRAPAPQEGEQDDLGPEKQKRRGRGRGRRYQKQGRESRQGAGGHGDLGRGR