McDonnell Genome Institute

Washington University

CircRNA

chr5|179888102|179888312|-|TBC1D9B|ENST00000355235.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9042

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

ASVVDPSTEVTIVEK

Amino Acids from 5' Exons

VTIVEKADSSSVLPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTE,PLSKKLTAPACCPAPCPSAPKAKHSCLPTKTVISWCRGSLTSSRKHHPSSQAVSGAGKPVLWTLAQ,DHCRKSQLQRAAQPPVHQHQKQNDIPVCQPERPFLGAEDLLPPENTIQAARQYREQESQCCGPHR

Amino Acids from 3' Exons

VTIVEKADSSSVLPSPLSISTKSKMTFLFANLKDRDFLVQRISDFLQKTPSKQPGSIGSRKASVVDPSTE,PLSKKLTAPACCPAPCPSAPKAKHSCLPTKTVISWCRGSLTSSRKHHPSSQAVSGAGKPVLWTLAQ,DHCRKSQLQRAAQPPVHQHQKQNDIPVCQPERPFLGAEDLLPPENTIQAARQYREQESQCCGPHR