McDonnell Genome Institute

Washington University

CircRNA

chr5|179823857|179825226|+|SQSTM1|ENST00000360718.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

NVGESVAAALSPLEK

Amino Acids from 5' Exons

RKKSAGGTTAHRVLRRRPATWCTPMSAMAAMGLWEPATSAASAQTTTCVASARERACTGGTPSSHSPAPSGTCL,EKRVPAGPPPTVCSGGAPQHGAPQCDLRWLQWACGRNPLQVQRLPRLRLVRLRGKGLAPGAHQARIPQPLRAPV,KKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSE

Amino Acids from 3' Exons

LLVHRRIRVISRTLGRVWQLPLALW,FWSIGGSECEFPEERWGECGSCPPS,SGPSEDPSVNFLKNVGESVAAALSPL