McDonnell Genome Institute

Washington University

CircRNA

chr5|179709872|179723019|+|CANX|ENST00000247461.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

21

Peptide

IVDDWANDGWGLKKAADGAAEDQFHDK

Amino Acids from 5' Exons

DQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL,ISSMTRPLIRLCLVQINVERTINCTSSSDTKTPKRVSMKKNMLRGQMQIRPILLIRKHIFTH,SVPQDPLYDYVWSRMWRGLTALHLPTQKPQNGYLRKTCEARCRSEDLFYENTSLHT

Amino Acids from 3' Exons

GIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAE,ESGNPGKYQIQISLKIWNLSELLLVLLVWSCGPPLTFFLTTLSFVLIEELMIGPMMDGARKLLMGLL,NLETQENTKSRFLRSGTFQNDSFCYWFGAVVHDLHFFQLYHLCSKNSLGQWMGPEESCWGC