McDonnell Genome Institute

Washington University

CircRNA

chr5|179617798|179618323|-|HNRNPH1|ENST00000329433.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9941

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

MTFIMYIEIFK

Amino Acids from 5' Exons

TSITVFQECLITDTGMVALLSRAQQDTVYTCGDYLTELLRMTFI,PQLLFFRNVSQIRGWWLYFPEHNRTLCTHAGITLQSYEHL,LNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYN

Amino Acids from 3' Exons

VYNLEQSSNSLSTTKAYGHAAARSLQTWGWRVQHWQRSWLEDEAWCLWW,YIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGG,ILKSLRAVELKLELIMIHHESLWPCSGQVLMTDLGLVEGITALAEELALRGGVVLMVE