top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|178206731|178207225|+|HNRNPAB|ENST00000355836.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

137

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

IFVGGLNPEATEEK

Amino Acids from 5' Exons

VLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGE,STRRSTGWMAVSLTLKRPWLRRTRRKSSLGVILKPLRKRSGSTLASLG,PRPEGAQAGWPCHPKGHGYEEGPGEENLRWGSESSHGKDQGVLWRVWG

Amino Acids from 3' Exons

IEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSK,LRPLNCQWIQSTKDEVLCLSPLKKKNPRRFWRKSSILSVEA,GHIANGSKVEQKTRFCVYHLRRRTREEGSGEKVPYCQWKQ

bottom of page