McDonnell Genome Institute

Washington University

CircRNA

chr5|177513352|177513484|-|DDX41|ENST00000330503.11

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9828

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

AGAASLDVIQGQR

Amino Acids from 5' Exons

GQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQ,ASDRPCSSVPPCRRRFRTLLRVPLSLPSMWGALGLPAWMSS,PATDPALQCHHAEEDSELCECPCKACDHQCGARWGCQPGCHP

Amino Acids from 3' Exons

GQRQTLLFSATMPKKIQNFAKSALVKPVTINVGRAGAASLDVIQ,ASDRPCSSVPPCRRRFRTLLRVPLSLPSMWGALGLPAWMSS,PATDPALQCHHAEEDSELCECPCKACDHQCGARWGCQPGCHP