McDonnell Genome Institute

Washington University

CircRNA

chr5|177459097|177467062|-|DBN1|ENST00000292385.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9462

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

20

4

Peptide

ALDEVTSSQPPPLPPPPPPAQEGR

Amino Acids from 5' Exons

AATWTATGGWRPLPSPRGARLTPAPPPPLSLSRSGPWMRSPPRSLHHCHRHPHQPK,QPPGQPPEDGAHSHPHAEPVLQHRLHPCRADRAGPGGHLLAASTTATATPTSP,SHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQ

Amino Acids from 3' Exons

KEEELRKEEERKKALDERLRFEQERMEQERQEQEERERRYREREQQIEEH,RKKSCGRRRSGRRPWMRGSGSSRSGWSRSGRSKRSASGATGSGSSRSRST,GRRAAEGGGAEEGPGEAQVRAGADGAGAAGARGARAALPGAGAADRGAQ