McDonnell Genome Institute

Washington University

CircRNA

chr5|176496485|176496663|+|FAF2|ENST00000261942.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9764

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

LESLTGFTR

Amino Acids from 5' Exons

SHRLYERTPIHSWPLCRIEGLWWDGKASFNLMTSLTNHLSWMLTRLTWCQNAK,LTGFTREHLSIPGHDYAEGSKDDCGGTARRPHSTPHPTDIYHGCPDLPGVRTPRK,SQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLE

Amino Acids from 3' Exons

SHRLYERTPIHSWPLCRIEGLWWDGKASFNLMTSLTNHLSWMLTRLTWCQNAK,LTGFTREHLSIPGHDYAEGSKDDCGGTARRPHSTPHPTDIYHGCPDLPGVRTPRK,SQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLE