McDonnell Genome Institute

Washington University

CircRNA

chr5|176492193|176499085|+|FAF2|ENST00000261942.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9774

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

RDGGRFALR

Amino Acids from 5' Exons

VCSSFYTAPSQPGHPRWGHCFIYALFREIWEGTPCLLPGNVQP,FALRFIRPDPRSRVTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQ,LLFVLYGLTLAAGSLTPLGTLFHLCTLLKRNMGGHTLSSTRERTA

Amino Acids from 3' Exons

GRKKPDPSAETTAGGLPGLSQSPGERKKETGGAGAAAEGGGGATAKVGRGETAA,EERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQ,KKETRPKCDNSRMRPTWPLSELTRRKKERNGRSGSVSGGRRRRCNSKSWQRRDGG