McDonnell Genome Institute

Washington University

CircRNA

chr5|175492094|175516663|+|SFXN1|ENST00000321442.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9364

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

SGTMSGELPPNINIK

Amino Acids from 5' Exons

SGTMSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDY,PGPCLENYHQTLTSRNLDGIKALSLDEPIISSLLTPGTFCPTNNSRVREKYMIT,RDHVWRTTTKHHQGTSMGSKHFHWTSQSFLHCNPQEHSVNQRTTRECEKNSTLQ

Amino Acids from 3' Exons

PSLHSLTLWKRKPF,HPSIHYEHFGKESLFE,IPPFIMNTLEKKAFLK