McDonnell Genome Institute

Washington University

CircRNA

chr5|173944966|173951938|+|CPEB4|ENST00000265085.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9425

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

AGQSSLFPMEDGFLDDGR

Amino Acids from 5' Exons

VSLHCFQWKMDSWMMAVGISLFIVAWVHLTASVTRMGKEWNDILERCLADCLQTLMK,SVFTVSNGRWILGWPWGSASSWPGFTSLLQSPEWGKSGTIFSKGVCRRIASRH,QSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLPPDIDE

Amino Acids from 3' Exons

VQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRA,SRFGLGISVTVTLWMVHSHLTHEKLYLLVVFLDHYEL,PDSALESQQLCDGWFTATPTKNYICWWCSSTITS