McDonnell Genome Institute

Washington University

CircRNA

chr5|172914713|172915690|+|ERGIC1|ENST00000520326.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.944

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

HPVAAGR

Amino Acids from 5' Exons

WLGLTFRMRWAGTKWATSTTPRSRTMGQAAASRGSSAST,GWAHSGDGQARSGPHRQLHEDPAEQWGRLPLRGAVQHQQ,VGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK

Amino Acids from 3' Exons

NQELQILSQVGERSALGRAEAPGGSWQGFAQHVPAFLEARYCHSGASQQRCEAAPFD,TRSFRSVKWVNAVPLGGPRHPVAAGRVLLSTCRPSSKLGTVTVEPLNNAVRQHHLT,PGASDPKSSGTQCPWEGRGTRWQLAGFCSARAGLPRSSVLSQWSLSTTLGSTIQ