McDonnell Genome Institute

Washington University

CircRNA

chr5|170034398|170047614|+|DOCK2|ENST00000256935.12

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9715

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LLLDTTAR

Amino Acids from 5' Exons

PDGMCCRAPNHCQVGGELREPGQRPPGEAAGLPGCDDREQRQPHELHREPA,LMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLL,WNVLQSTQPLPSRWRTSTWSKASWRSCWITGVQMRAKTTAAAPTC

Amino Acids from 3' Exons

IQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLR,SSRQNSMKASKSSGPNQTTLLLDTTARDSPPSC,PAGKILKHHENPQAQTRLLCCWILRPGIPLLPA