McDonnell Genome Institute

Washington University

CircRNA

chr5|168806445|168817463|-|SLIT3|ENST00000332966.8

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9001

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LMEIPANLPEGIVEMR

Amino Acids from 5' Exons

PPTRSPHPAMPTPSPALRPARAAITSWTVEERAWRFLPTCRRASSK,PPLGAPILQCQLHLLPFALHVQQHRGLSRKGLDGDSCQLAGGHRRN,PHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLMEIPANLPEGIVE

Amino Acids from 3' Exons

APPLQPPVLRLPPGLALGLAATATDSWPVHTLHGSCAFEGLQRGGCAEEGVRVP,RLHSNHLYCDCHLAWLSDWLRQRRTVGQFTLCMAPVHLRGFNVADVQKKEYVCP,ASTPTTCTATATWPGSRIGCDSDGQLASSHSAWLLCIGASTWRMCRRRSTCAQ