McDonnell Genome Institute

Washington University

CircRNA

chr5|168748301|168753098|-|SLIT3|ENST00000332966.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.934

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

DVTELMLR

Amino Acids from 5' Exons

ATRRVAASARAARSSAPVWRQWCDAATRGSAPSPEACPRMPS,QRGELPAEPALPGAVHLYGDSGAMQQQGAPRPPQRHAQGCDRA,NEESSCQLSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTE

Amino Acids from 3' Exons

DAEELDRLCEHLCRPEFGETAVPLQSDHHHHPWGLHHACLPVHH,MLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLST,CGVTSAVVMTPLPAVRDCCPSMTIGSPPSPLGPSPRLSPCPP