McDonnell Genome Institute

Washington University

CircRNA

chr5|157319761|157325638|+|CYFIP2|ENST00000435847.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9899

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

TFHDGVIAMIK

Amino Acids from 5' Exons

VIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLI,SPSKACRCSWAGWRASSTRPSGTPSTRHCRTSPRRCVSPCGRRYGRRRMSSS,DRHDQRPAGAHGQDGERLQPGHQEHHLRGIAGLRPGDAAAPAAGGTEEEECPHQ

Amino Acids from 3' Exons

KPCSSVVTSPSSGSENSSWSPWADESSSPSRCPCPGFRTISWKPKNLPW,SPAAVLPLPALVPRILPGVNHGPTNPVPHRDVHALDSNGPYPGNQRTFHDG,ALQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEPSMM