McDonnell Genome Institute

Washington University

CircRNA

chr5|156344488|156393865|+|SGCD|ENST00000524347.2

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9405

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LAIQMLWNELR

Amino Acids from 5' Exons

MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTI,CLRSSTLTTGAPCLALWGHRYTRWGFMAGGNDACISLSCSSFYWTWPPSGFSKSTSQ,ASGAVHSPPEHHAWLCGATGIQGGDLWLAETMPVFLCPAPHDFNTGELGHDHLDSQSHELHN

Amino Acids from 3' Exons

SIHLLLRFNWLFRCCGMSEEPEPGARLRFQYPLCC,ASICFDLTGYSDVVEAERSQNQEPGDSDSSTHFAA,HPSASEILAIQMLWNELRGARTRSQVTQIPVPTLLL