McDonnell Genome Institute

Washington University

CircRNA

chr5|154924468|154927550|-|GEMIN5|ENST00000285873.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9943

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LELMMEK

Amino Acids from 5' Exons

LCWHPTKEGCLAFGTDDGKVGLYDTYSN,CAGTQPRKVALLELMMEKWDCMTPTPT,VLAPNQGRLLSFWNWKSGIVHLLQQ

Amino Acids from 3' Exons

RTVAMGSHSILETEIHPLQCLIRRAKSFKNCVFMSFTNRGQTAITFYINGR,GELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD,VNCCNGISLNLGDGNTPSSVPHQKGKIIQELCLIYVLYKQRMTNSYYFLHQWIE