McDonnell Genome Institute

Washington University

CircRNA

chr5|154916997|154928659|-|GEMIN5|ENST00000285873.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9042

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

TVIGVMILK

Amino Acids from 5' Exons

INRNISDSQPETDLYYPTASQACEYHLASAWQPARIELSDGLWLQQCSHLRAQPEDCH,SIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLMASGSNNAVIYVHNLKTVI,QKYFRFPTNSVLSNSITSLIPLAGIMSMAASQNAIWPLAPTMQSFTCTTRLS

Amino Acids from 3' Exons

GFNCPFREEEGVTQLLKSAFGHSIGPAINQHSWYLAVL,GDDFEIALSEEKRRGYRPNCRAPLVDTPLAQQSTNTAGILFW,VMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLVSSCF