McDonnell Genome Institute

Washington University

CircRNA

chr5|153997802|154028283|-|FAM114A2|ENST00000351797.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9663

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

EFTTCLTTAGGK

Amino Acids from 5' Exons

DDNCVVRVVLSVRVHYLPNNCW,MTIVLCKELSSLSKEFTTCLTTAG,QLCCVKSCPLCLKSSLPAQLL

Amino Acids from 3' Exons

GKSVISGGLDALEFIGKKTMDVIAEGDPGFKRTKGLMNRNATLSQ,ERVLVGVWMPNSLEKRQWMQKGILDLKEPRVTEMLHYL,KECYKWGFGCLRIHWKKDNGCDSRRGSWIKNQGSDEPKCYTIS