top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|151786602|151791062|+|G3BP1|ENST00000394123.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9821

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

10

Peptide

FMQTFVLAPEVELTK

Amino Acids from 5' Exons

VELTKAMVMEKPSPLLVGREFVRQYYTLLNQAPDMLH,LNPKQWWRSLVPCWSGGNLDSITHCTRPQTCCI,IDQSNGDGEASPAGRAGICETVLHTAEPGPRHAA

Amino Acids from 3' Exons

EIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPE,KSTGKCHKTSPTATPRFAMLMLMPRMMVWSRWGFSLTTTRLGDSCKRLSLLL,NPQESDVTKLHQLPHQDSPCCSCHAKWCGSPGDGASLQQPGFEEIHANVCPCS

bottom of page