McDonnell Genome Institute

Washington University

CircRNA

chr5|151056765|151056957|-|TNIP1|ENST00000315050.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9671

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

VHKNEQRTSILQALGPLPR

Amino Acids from 5' Exons

ALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQ,RWAPCPVRTATCCTCSAWRPRVCVPRSRTTASSSPTWAAWPWSSTDWHPRCTRMSSAPPFC,AGPPAPGRQPDAAPAAPGDHAECVCRGAGPRPALHPPGPHGPGVQPTGIQGAQEAAHLHSA

Amino Acids from 3' Exons

ALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQLFTHLGRMALEFNRLASKVHKNEQRTSILQ,RWAPCPVRTATCCTCSAWRPRVCVPRSRTTASSSPTWAAWPWSSTDWHPRCTRMSSAPPFC,AGPPAPGRQPDAAPAAPGDHAECVCRGAGPRPALHPPGPHGPGVQPTGIQGAQEAAHLHSA