McDonnell Genome Institute

Washington University

CircRNA

chr5|151042539|151045950|-|TNIP1|ENST00000315050.11

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.96

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

7

Peptide

IEMEEASVTAGK

Amino Acids from 5' Exons

ITELRQKLADLQKQVTDLEAEREQKQRDFDRKLLLAKSKIEMEE,SLSCVRSWLICRSRLTWRPSGSRSSVTLTASSSWPSPRLKWR,HAASEAGFAEAGDPGGRAGAEAALPQAPPGQVQDNGG

Amino Acids from 3' Exons

ASVTAGKVPEVVALGAAEKKVKMLEQQRSE,LVRQVRSQRWWPWAQPRRRRCWSSSAV,CDGRGPRGGGLGRSREEGEDAGAAAQ