McDonnell Genome Institute

Washington University

CircRNA

chr5|150618102|150618767|+|SYNPO|ENST00000394243.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9295

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

AASHQRR

Amino Acids from 5' Exons

IAPKRPHTRDGLRRGIGGPPLHPRKDLSFVSARPHPNSVNQRRKAKVQRVRGGCVRSRDQGSHSWPQPRPWPRPRSLLPCIAEEEQHHAGSSPPTSAPCTQRREAYPLRLPDPWKLQVSGSGSRGEQRGGPAGRGGAYRPGRGGGQQEWGRLCLQSHPGDTAAAQSPGHPTTQLLQRGTRGVPARRQGQPGLGCSEGRADDDSQPQPWPWAQSGPET,LPQSGLTPETGEEGLEVHHSTSPGRTYLSSQPDLTPILISGGRQKCRESEEAVGAETRAHTAGPSPGPGPGPGACFPASLRKNSTMLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKP,CPKAASHQRRVKKRDWRSTTPLAQEGLIFRLSQTSPQFCESAEEGKSAESQRRLCKEQRPGLTQLAPAQALAQAQEPASLHRGRTAPCWVLTSHLRPLHPAKGGLPPAPSRSLMEATGVWLWKPRRAAVRRACRERWGLPTWKRMRGSAGVGTTLPAESPRGHRSCPKPWASNHPAAPERNKGRPSTTTGPARTGMRPGRQPAPALALGPEWPRNQ

Amino Acids from 3' Exons

IAPKRPHTRDGLRRGIGGPPLHPRKDLSFVSARPHPNSVNQRRKAKVQRVRGGCVRSRDQGSHSWPQPRPWPRPRSLLPCIAEEEQHHAGSSPPTSAPCTQRREAYPLRLPDPWKLQVSGSGSRGEQRGGPAGRGGAYRPGRGGGQQEWGRLCLQSHPGDTAAAQSPGHPTTQLLQRGTRGVPARRQGQPGLGCSEGRADDDSQPQPWPWAQSGPET,LPQSGLTPETGEEGLEVHHSTSPGRTYLSSQPDLTPILISGGRQKCRESEEAVGAETRAHTAGPSPGPGPGPGACFPASLRKNSTMLGPHLPPPPLAPSEGRPTPCAFQIPDGSYRCLALEAEESSGEEGLQGEVGPTDLEEDEGVSRSGDDSACRVTQGTPQLPKALGIQPPSCSREEQGASQHDDRASQDWDVVKAGQMMTASPSPGPGPRVAQKP,CPKAASHQRRVKKRDWRSTTPLAQEGLIFRLSQTSPQFCESAEEGKSAESQRRLCKEQRPGLTQLAPAQALAQAQEPASLHRGRTAPCWVLTSHLRPLHPAKGGLPPAPSRSLMEATGVWLWKPRRAAVRRACRERWGLPTWKRMRGSAGVGTTLPAESPRGHRSCPKPWASNHPAAPERNKGRPSTTTGPARTGMRPGRQPAPALALGPEWPRNQ