McDonnell Genome Institute

Washington University

CircRNA

chr5|150024261|150032603|+|HMGXB3|ENST00000503427.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AIEKPAK

Amino Acids from 5' Exons

EKPAKVKVELASGVSSKGSVVKRNQQPVTTEQNSSKENASKLTLENSEA,KSQPKKWNWLLASLPKALWKEISNLSPLSKIPLRKMPPNLWRIRK,KASQSKSGIGFWRLFQRLCGEKKSATCHHAKFLGKCLQTDSGEFGS

Amino Acids from 3' Exons

DLGLATSRGRGKCKNPSCSYVYTNRHKPRICPSCGVNLAKDRTEKTTKAI,IWAWLHQEAGESARIPLVAMSTPTGTNLEFVPAVVLTLPKTGLRKPPRL,FGPGYIKRPGKVQESLLLCLHQQAQTSNLSQLWCPCQRPDENHQGY