McDonnell Genome Institute

Washington University

CircRNA

chr5|149826672|149837073|+|PPARGC1B|ENST00000309241.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

RTQGSAPLALTTAPTR

Amino Acids from 5' Exons

IDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGDALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSL,LTVRMRPSWQSSPRPWMTSLKMTWVWLPSQPWMVETLYHAPQLRLPPHLHPPALPRRSPRPQPLRWTSSH,QEGPPGRAHQDPGHPRRGSGCLPSPGWWRRSIMHLSFACPLICTPQPCPGEALGPSPGGRALT

Amino Acids from 3' Exons

DSPHPPHHRTSPQRRIPSNQTSSIVAKKLSASPPLRASHSRPPQGLPTSCQRSTQSEVSSCPTCDMPQPSQPPRLARSVPSPVPLETMTTARCSDQKASCKGRCGPGSRLGFTLRTGPSRVPLGLRHRPLAGRKTEAVMLAPHPRTARCETMRSVPASPNTLGCWRPPWRRKTWPPARALSMTLSLKTAAAAAARAASSQRRKRKKGRRRRRTMKKRTQGSAPLALTTAPTRAHQARPTGSSVPAAAQALALHPATPGHQPLEGTS,THPTHHTTVQAHRGGSLQTRHQASRQRNSSQPPLPGPLTQGHPRGCPQAAKEAPRAKAPVPPATCHSPASLPGWPEASLLLFLWRPLLPGAPTRRRPAKEGAEVLGAVWGSPGLAPAGCPLGGTGPWQGGRQKLCWRPTQGQHAAERPDPCQPHQTLWAAGDRPGGGRPGLLQEPVHCLRQQQQQRREQLPPRGGRGRRGGGGGGRRRGLRGQPHLLPLPLPEPTKQGQPAALFPQPLKLWLFTLPLLVTSHSKELQ,LTPPTTPPYKPTEEDPFKPDIKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPSGVHLEDWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGLLETALEEEDLASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSPPSKANRQLCSRSRSSSGSSPCHSWSPATRRNF