McDonnell Genome Institute

Washington University

CircRNA

chr5|146478492|146498686|+|TCERG1|ENST00000296702.9

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9788

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SLWPLLGR

Amino Acids from 5' Exons

VCRLDWAGLLLSHHSSFYVGPTSDWQGRCQNYSGAPSKRNGGIEET,CVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKL,VSFGLVMSGSSFIIPPLVFLCGTDLMILAGQMLTKLFRSPLIKKEWRNRN

Amino Acids from 3' Exons

SNFICSQACRFKIQSNKDERPRSLVVCGRCEERERRFEDQRE,ATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEK,QLLVNLQPSMLKIQDSKQLKRKTEKPCLMSLWPLLGRKRKKIRRPEVR