McDonnell Genome Institute

Washington University

CircRNA

chr5|143120987|143134105|+|ARHGAP26|ENST00000274498.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9226

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

ETVANNHK

Amino Acids from 5' Exons

CCQPQAEFDDGGKPWCGVWTHSAEASGRNSSSHHGHQISEHCHDPNRKPRK,VANNHKQNLMTVANLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEK,LLTTTSRIRWQTLVWCLDPLCGLRKKQQPSWTSNFRTLSLRSKTTK

Amino Acids from 3' Exons

IFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERPLTLFHTVQSTEK,YLTPCPICLSPMPSCTCLGRRAVTPSPRPAARGPRSSTPFSQQRN,IHRARYASHQCPAAPVSEEEQLQAPVLQREAPDALPHRSVNRE