McDonnell Genome Institute

Washington University

CircRNA

chr5|14270824|14316743|+|TRIO|ENST00000344204.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

12

Peptide

LQLCVFQQDVQQGFEK

Amino Acids from 5' Exons

GFEKTMKKLWMFYQFRKKLHTFQ,VSKKRNESYGCFTNFEGKSCIPF,FRKNDEMKAMDVLPILKEKVAYLS

Amino Acids from 3' Exons

VSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQ,SAKMGSRSLTSSSGPLPAAPIPQPLPTTPRPCTMSWMSSTRCCTTSGSWRTSGNTARSGCIRGCSCVFSSRTFS,QPRWEVAPQAPAALDSRQLRFPDSLCQLLQGRAPCPGCHPRGAAPPAAAGEHLATPQGPAASEAAAVCFPAGRSA