top of page

McDonnell Genome Institute

Washington University

CircRNA

chr5|141973582|141980351|+|RNF14|ENST00000347642.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9962

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

VTAGPYVVRR

Amino Acids from 5' Exons

VLMSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVS,SLCRQKIEKLRRMNCWPWQVFTMEMNLEKQSLSKVEKPGSIWICHRISRYLA,PYVVRRSRSSGGIAGPGKYLRWRIKSRVCPRWRNQDLFGFATEFQDICE

Amino Acids from 3' Exons

VKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTA,SKSWKQSYLPVMTAFSSSPPWTWQMWCTAPGRAASCLCRNLAAPWVSAPAAILPSVLCAGPTMGSPHVRLQ,QRVSGSRVICPLPPSPPVLLGPDGRCGVLPPAVLPAACDAGTWLHHGYLLQLQFCLLYFVQVDLPWGLPMGDC

bottom of page