McDonnell Genome Institute

Washington University

CircRNA

chr5|141661683|141662255|-|ARAP3|ENST00000512390.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9067

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LGSGGGGK

Amino Acids from 5' Exons

GSGWKVYTGKGALVPAADSWLSSVGMPGRSSDQGSTLWRMSLTHSNASFVSSMTLPLHGCCLAGGRLLVFLRSLRAKAQPGSLPSPTRIHGLAALRPITSHPGGSSRDLAQGEVGRGQRHIHPAFVPKNPSLCTSCHSFFPGPPQPSSIPSPELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLY,APAGRCIPERGRSCPQPETPGVPSGCPVGEAPTRGALCGGCHHTQTLLSARPCDLCTVAASLEGGCWYSDPEPRPNQDLCLPPPESMVWQPSAPSLPTLGDHPETWLRGRWEGGRDTSILHLCLKIPPSVPAATLSSRVLPNPPPFHPQSCPRRISAWRNIKMLAACRGSTAAHWPPSLGISI,LRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAGIPKIPESQGPTRISAFPHQNPWFGSPPPHHFPPWGIIQRLGSGGGGKGAETHPSCICAKSLPLYQLPLFLPGSSPTLLHSIPRAAPEESAPGEIRCDWLPAAGQPPHTGHPHWASLS

Amino Acids from 3' Exons

GSGWKVYTGKGALVPAADSWLSSVGMPGRSSDQGSTLWRMSLTHSNASFVSSMTLPLHGCCLAGGRLLVFLRSLRAKAQPGSLPSPTRIHGLAALRPITSHPGGSSRDLAQGEVGRGQRHIHPAFVPKNPSLCTSCHSFFPGPPQPSSIPSPELPQKNQRLEKYKDVIGCLPRVNRRTLATLIGHLY,APAGRCIPERGRSCPQPETPGVPSGCPVGEAPTRGALCGGCHHTQTLLSARPCDLCTVAASLEGGCWYSDPEPRPNQDLCLPPPESMVWQPSAPSLPTLGDHPETWLRGRWEGGRDTSILHLCLKIPPSVPAATLSSRVLPNPPPFHPQSCPRRISAWRNIKMLAACRGSTAAHWPPSLGISI,LRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAGIPKIPESQGPTRISAFPHQNPWFGSPPPHHFPPWGIIQRLGSGGGGKGAETHPSCICAKSLPLYQLPLFLPGSSPTLLHSIPRAAPEESAPGEIRCDWLPAAGQPPHTGHPHWASLS