McDonnell Genome Institute

Washington University

CircRNA

chr5|141526037|141527697|-|DIAPH1|ENST00000253811.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

EQLIDMNAVSAENLQK

Amino Acids from 5' Exons

QAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNA,KQSRRTRSGGRQKKRGEQNPRRRQRRSGRSSRRESNSTMQ,SSQGEPEAAGDRRKDEASKTSQGEGREGAAREAAEERATHRHEC

Amino Acids from 3' Exons

FLLKTCKRTIRRNKFLMWNVMFRISQLPQMKKTSLLKKP,FCKLAKEPRSDEETNFCGTCSEFPSCHRKRQVCKNDH,SAENLQKNLDQMKKQISDVERDVQNFPAATDEKDKFVEKMT