McDonnell Genome Institute

Washington University

CircRNA

chr5|140507784|140535538|+|ANKHD1|ENST00000360839.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9607

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LKLMTGSK

Amino Acids from 5' Exons

DWETRYFSPDVGCNEWTCSCSKIAARYGFRHCPNRDQSEHGSHPGLFPGPSRSSEFASGPKSQCTGK,TGSKLGISPLMLAAMNGHVPAVKLLLDMGSDINAQIETNRNTALTLACFQGRAEVVSLLLDRKANVEHRAK,LGVNVFLPCWLQMDMFLQNCCSIWVQTLMPKRPIGTRLSPWPVSRAEQKVCFWTEKPMLNIGQ

Amino Acids from 3' Exons

GYHPLTHQAAPHLPLLLLWQVFPAYQEQGFSCKGQLLLGLLVSTDNIFLPILGQAPQTH,VTIHPIRQLPIFLFCSSGKFFRHTRNKGFPARASSCWDSFQQTTFFSPSLDKRLKL,LPSIDPSGSSPSSSSAPLASFSGIPGTRVFLQGPAPVGTPSFNRQHFSPHPWTSASNS