McDonnell Genome Institute

Washington University

CircRNA

chr5|140496519|140542281|+|ANKHD1-EIF4EBP3|ENST00000532219.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

IGRPMVASPNQR

Amino Acids from 5' Exons

VHPSRSPVPSRQIRTYCHLFTHTSLWSARRLKASMNWDKELVLLKKHSLSHWSFKVNLTKIRKNLKRTEKSKSRRRRKYKNCRKWKGSCRKHSSNLPKNTWKPKVRKTQCLYTNSALIEESSQKGKEMVVSQRITFQSYLRLTQSYLKIMMLMMSNSLHHRQNRLILSQSSLYHLHSVTFPVTVLMGQILLNFRKYQVISRLDSLRLLLLDMIRGCFKNQMDWLQLQLRRLPTLLMTQ,YIQAEVQFPPGSRSGPTAIFSPIPAFGVHSRGDRQAETGTKNCYKSTAVTGVNSRTSEQRDRRTKEQRRASPEEEENIERTAESGKAVADENTAAIYQRILGNQRSERHSVSTPTVLSRSLPRRGRRWSPRGSLFRVTSGHNLIRCATVSTIGRTDFCPSPAFIISTVLFQLRFWDKFSTSESIRSADCRTASDCYYWTSGAVSSRTRWTNGCNSSSDAYRHSPDS,TSKQKSSSLQVADQDLLPSFHPYQPLECIVEETEGKLNELGQRISAIEKAQLKSLELIQGEPLNKDKIEELKKNREEQVQKKKKILKELQKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPDGLMVATPAQTLTDTLDDLIA

Amino Acids from 3' Exons

ASLLPSVPALKGEIPSPQLTRPKKRIGRPMVASPNQ,PVCFLQSLLSKGKSHHLSPDRRRELDGRWWPLLTR,QSASFSPCSQRGNPITSANQTEEENWTADGGLSPE