McDonnell Genome Institute

Washington University

CircRNA

chr5|140438460|140459355|+|ANKHD1|ENST00000297183.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9834

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

YLLASGIGK

Amino Acids from 5' Exons

ELANCQLLMVKLLQILRYSGDHPQLVVHWMKLLLHHGKQKTATMQDKWT,NWQIVNCWSFCRSGTPETDILSLCTGSCCCTDTDESRKQPQCRTSGH,IGKLSTADGKAFADPEVLRRLTSSVSCALDEAAAALTRMKAENSHNAGQVD

Amino Acids from 3' Exons

EQIMPRQKKLKKLLLLWLAVEDFLKLQTFLLRQGLINLAAPHLWRHLRRDTWNWLNICWLL,SKYKCPDRRNSRNCSYFGLLWRIFSCRLSYGRGYRTWLLHTSDGGISGGTPGIGIFAGF,ANINAQTEETQETALTLACCGGFSEVADFLIKAGADIELGCSTPLMEASQEGHLELVKYLLAS