McDonnell Genome Institute

Washington University

CircRNA

chr5|139325295|139326284|+|MATR3|ENST00000361059.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

2

Peptide

RFPGSMEGFVTLDEVGDEEDSELQK

Amino Acids from 5' Exons

RRFPGSMEGFVTLDEVGDEEDSELQKLRKSGMAFKSGDKNDDGLVEIKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPV,VVFQGVWKVLSLMRLVMRKIRNFRNFVNRAWHLNLVTKMMMVWLKLRWTRSRNLIKKTKQRWKMELKMRKTQNQVLNLLRTLMIPTKIQVKTQMVKVMRTRTTIQSQMSIELDHISPMFLL,SFSREYGRFCHSRGWGRFGTSETSIGHGIIWQKWFGNGGQDRGTSRKRSSVGKWNKGKHRTRCIFERSQQRYKKRRWSKEQGRLYNPRVNWTISAQCSC

Amino Acids from 3' Exons

VTMYLKQGFTVSCVHSFIQMKKLQRILIAAAFLIIRN,YRLCDTNRVLLAVFTLLYKRSCKEYSLQQPSSLSEIK,IDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLK