McDonnell Genome Institute

Washington University

CircRNA

chr5|139318907|139322967|+|MATR3|ENST00000361059.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

30

2

Peptide

KAFIEMATTEDAQAAVDYYTTTPALVFGKPVR

Amino Acids from 5' Exons

AFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIK,HLLKWQPQRMLRPQWIITQPHQRYLASQEFIYPRSIKE,IYNGNHRGCSGRSGLLHNHTSVSIWQASESSFIPEVKNK

Amino Acids from 3' Exons

KKILLSRWQRISKEIQNWFPEDEFNRRRTRREVRRWERHKGPDRAGTYASIRATCRRRSSSTARKWQFSGRRDRSCFRCGFWEKGTIRSCEKRWKCFSSSKEKAK,KRSYSPDGKESPSDKKSKTDGSQKTESSTEGKEQEEKSGEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGSASAAAKKKLKK,KDLTLQMAKNLQVIRNPKLMVPRRLRVQPKVKNKKRSPVKMVRKTQRMTRQSRNLICFLNLKMSYLMKKKQQHCKVAVQWETRPILLIVMWLLMGKRNHQIKLKKMEVLQQQQRKSLK