McDonnell Genome Institute

Washington University

CircRNA

chr5|139315696|139325662|+|MATR3|ENST00000361059.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

SGDKNDDGLVEIK

Amino Acids from 5' Exons

LPRMESQYRTHN,YPEWNPDNDTGHT,TQNGILTMIQDTQ

Amino Acids from 3' Exons

RRFPGSMEGFVTLDEVGDEEDSELQKLRKSGMAFKSGDKNDDGLVEIKVDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPV,VVFQGVWKVLSLMRLVMRKIRNFRNFVNRAWHLNLVTKMMMVWLKLRWTRSRNLIKKTKQRWKMELKMRKTQNQVLNLLRTLMIPTKIQVKTQMVKVMRTRTTIQSQMSIELDHISPMFLL,SFSREYGRFCHSRGWGRFGTSETSIGHGIIWQKWFGNGGQDRGTSRKRSSVGKWNKGKHRTRCIFERSQQRYKKRRWSKEQGRLYNPRVNWTISAQCSC