McDonnell Genome Institute

Washington University

CircRNA

chr5|138781922|138783372|+|CTNNA1|ENST00000302763.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9923

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

KQEMTAVHAGNINFK

Amino Acids from 5' Exons

KLLSMQATTSSGILKVRSGLWQLRDCWSLLLH,NDCCPCRQHKLQVGSKSRDQDSGSETVGASCYT,MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQ

Amino Acids from 3' Exons

VTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ,LQPLTPIVKGPLIRREVVLRRPMFWLHLLNKQLRISWRRGIKLRRRASFSRRSLWLLKMFENK,YNPCKHQRALEERSFEGPCFGCICTSNEFLGEGGNCEGEPVSQGGACGCCRRCSKT