McDonnell Genome Institute

Washington University

CircRNA

chr5|138570959|138574126|-|HSPA9|ENST00000297185.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9379

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

DMIAGMALVMR

Amino Acids from 5' Exons

VLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKD,CWRMPKVPEPPLQLWPLQQMVSDLLECRPSDRLSPTQTIHFMLPSVSLAGDMMILKYRKT,AGECRRCQNHPFSCGLYSRWATCWNAGQATGCHQPKQYILCYQASHWPAISSTERH

Amino Acids from 3' Exons

DSWNGLSHEAFRLVSRRDY,IAGMALVMRLLDLFQGGIM,LEWPSGFTCFKAGLC