McDonnell Genome Institute

Washington University

CircRNA

chr5|138559863|138561789|-|HSPA9|ENST00000297185.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9133

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

SQTDINLPYLTMDSSGPK

Amino Acids from 5' Exons

VQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQ,FSRLYRIFLAEPQVKLSILMRLWPLELPFREVCWPAMSRMCCSLMSLPCLWVLKLEVSLPNLLIGIPLFQPRRA,SADCTGSFWQSPKSCQSGCGHWSCHSGRCVGRRCHGCAAPCHSPVSGYNSRRCLYQTYEYHYSNQEEP

Amino Acids from 3' Exons

TDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPK,LTSICPILQWILLDPSIISPVLNLKGLSLISEGLSLHAKKLCKMQKSARVTEKFLWVALGCP,HQFALSYNGFFWTQAFEYEVDPCSIRDCHSNQKDYRSMPKSYARCRSQQEHRRSDSCGWHDDAQ