McDonnell Genome Institute

Washington University

CircRNA

chr5|138556451|138561789|-|HSPA9|ENST00000297185.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9303

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

16

Peptide

KTDINLPYLTMDSSGPK

Amino Acids from 5' Exons

CNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKK,ATSKKRFPKGSSWLEKTAKQEKILDRQHPLFSRHHSCSKWHTK,QQAERRDFQNEGAPGKRQRNRRKYTGSILSSAGITEAVRNGIQK

Amino Acids from 3' Exons

TDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPK,LTSICPILQWILLDPSIISPVLNLKGLSLISEGLSLHAKKLCKMQKSARVTEKFLWVALGCP,HQFALSYNGFFWTQAFEYEVDPCSIRDCHSNQKDYRSMPKSYARCRSQQEHRRSDSCGWHDDAQ