McDonnell Genome Institute

Washington University

CircRNA

chr5|138420705|138424341|+|KDM3B|ENST00000314358.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9658

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LEDLPGVLEAR

Amino Acids from 5' Exons

KQGPGRCSIKSLIHPLGWTRSTPLQRSLRLQSFLTVCCWVPLPPTTKPKGLAFETSFTPGRENFLKPPWTQAYPFPRSSLHPQ,SRVPEVGAQRVSFTLWAGLVQLHCKGLSADSKAFQSVAGSHCLQQQNRRVPSRPPSLRAGKTSSNPLGHRHTLSPGLLYILS,AGSLRSVLNKESHSPFGLDSFNSTAKVSPLTPKLFNSLLLGPTASNNKTEGSSLRDLLHSGPGKLPQTPLDTGIPFPPVFSTSSA

Amino Acids from 3' Exons

GVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQ,ERARPAYPTFLTTSLPQWKIRKPQMLQSGPATLIPRRKRRWWGMCIPILLTPGFVMGGFCVSMTPATKTIGRSSGSVGSKV,SEEQGQPTQLSPHHCLSGRKENLRCFKAGLQLDYPEGSEGDGDGVKCARSPYFSLLALWEASVSPPQQQKQLEDLPGVLEARS