McDonnell Genome Institute

Washington University

CircRNA

chr5|138381515|138424341|+|KDM3B|ENST00000314358.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9699

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

QGQSGEIK

Amino Acids from 5' Exons

SGEIKSVDPRLIHVMLMDNSAPQSE,VVRSSRIPDSMCWIIQRLKA,WDQVGRSQTNPCDADGFSASKR

Amino Acids from 3' Exons

GVKSKASLPNFLDHIIASVVENKKTSDASKRACNLTDTQKEVKEMVMGLNVLDPHTSHSWLCDGRLLCLHDPSNKNNWKIFRECWKQGQ,ERARPAYPTFLTTSLPQWKIRKPQMLQSGPATLIPRRKRRWWGMCIPILLTPGFVMGGFCVSMTPATKTIGRSSGSVGSKV,SEEQGQPTQLSPHHCLSGRKENLRCFKAGLQLDYPEGSEGDGDGVKCARSPYFSLLALWEASVSPPQQQKQLEDLPGVLEARS