McDonnell Genome Institute

Washington University

CircRNA

chr5|138377719|138386621|+|KDM3B|ENST00000314358.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

11

Peptide

QKGSRSQASGEMGTDSQNQILLEHAALR

Amino Acids from 5' Exons

MGTDSQNQILLEHAALRETVNALISDQKLQEIFSR,WEQIAKTRFFWNMLHEKQLMLSVTKSYKRYSAE,GNRPKPDSFGTCCTERNSCFDQPKATRDIQP

Amino Acids from 3' Exons

GGTLKAVKSSKGKKKRESIEGKDGRRRKSASDSGCDPASKKLKGDRGEVDSNGSDGGEASRGPWKGGNASGEPGLDQRAKQPPSTFVPQINRNIRFATYTKENGRTLVVQDEPVGGDTPASFTPYSTATGQTPLAPEVGGAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPEKQKGSRSQASGE,GVRKQNLPKERRREKARGKMAGGGKVLRTLGVTLHQRNKETGVKTVMGAMEVRQAEGPGKEGMPVESQGWIREPSSHRLHLSPRTATFALPLTPKKTAGLWWCRMSLVGTHLHLSLHILQPQVRHLWPQRWVEPKTKRQEKHWNKLARAWLPQLWSLPPAPPQTQGSQTLALQQGLCQKNRKAAGRRPRE,GYVKSSKIFQRKEEERKHRGERWPEEEKCFGLWVPCIKEIKRRQGSRQWERWRGKPRALERRECQWRARAGSESQAATVYICPPDKPQHSLCHLHQRKRQDSGGAGACRWGHTCIFHSIFYSHRSDTFGPRGGWSRKQRGRKNTGTSWPGHSGFRSCGHYRQLHPKHSEDLRHWPCSRDCARKTERQPVAGLGR