McDonnell Genome Institute

Washington University

CircRNA

chr5|137870440|137871007|+|MYOT|ENST00000239926.8

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9442

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

33

Peptide

FSASSTLSSHITMSSSAFPASPQQHAGSNPGQR

Amino Acids from 5' Exons

EQYSSREGHSTKARSTVFSGSQQGRADQGCFFLTTFRNSRLVAPNSGPHPSRNKSLFAFIFHIPTKHVLRTSKTLHPVPKPMWLQIAASWTRNLQLLPDQTVFHYHPAPPVYRAKIFCLLNTELSHHHVLLCFPCFSPAACWLQPRPKGYNHLPVPSQLPQLHITITALQQNPFRYGFQ,NNILQEKVTLPKPGAQYSQDLNKEEQTKVASDSLQPSVIPGLWPQIQGPTLPGTNHYSNNLPSSSIYQLSMFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDS,TIFFKRRSLYQSQEHSILRISTRKSRPRLLLIPYNLPFQACGPKFRAPPFQEQIIIVIICLHLPYTNACLTTNVQNTSSSPKTHVAPDCSLLDQKPPASLARPNSLPLSSSPASVQSKDFLPPQHALTSPCPPLLSLLLPSSMLAPTQAKGLQPPITSPQPASSAPYYHHSLITIAVKSLPLWIP

Amino Acids from 3' Exons

EQYSSREGHSTKARSTVFSGSQQGRADQGCFFLTTFRNSRLVAPNSGPHPSRNKSLFAFIFHIPTKHVLRTSKTLHPVPKPMWLQIAASWTRNLQLLPDQTVFHYHPAPPVYRAKIFCLLNTELSHHHVLLCFPCFSPAACWLQPRPKGYNHLPVPSQLPQLHITITALQQNPFRYGFQ,NNILQEKVTLPKPGAQYSQDLNKEEQTKVASDSLQPSVIPGLWPQIQGPTLPGTNHYSNNLPSSSIYQLSMFNYERPKHFIQSQNPCGSRLQPPGPETSSFSSQTKQSSIIIQPRQCTEQRFSASSTLSSHITMSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDS,TIFFKRRSLYQSQEHSILRISTRKSRPRLLLIPYNLPFQACGPKFRAPPFQEQIIIVIICLHLPYTNACLTTNVQNTSSSPKTHVAPDCSLLDQKPPASLARPNSLPLSSSPASVQSKDFLPPQHALTSPCPPLLSLLLPSSMLAPTQAKGLQPPITSPQPASSAPYYHHSLITIAVKSLPLWIP