McDonnell Genome Institute

Washington University

CircRNA

chr5|137638952|137639977|-|KLHL3|ENST00000309755.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9981

66

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

SAGAHWAQR

Amino Acids from 5' Exons

VWCSWLATCMPWEGLMAHCGCGQWMCMTARTSGRPLPACRSAGAHWAQRCSMTCSTQWEALMAVL,CGVHGWPRVCRGRVWLTAGADSGCVRREGPVDVHCQHAGAPEHTGRSGAQLALRSGRLWQY,VVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGST

Amino Acids from 3' Exons

VMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRA,SLWLAARHPRQSAVWSAMISRRTGGIRLLSFLPEDAEQ,HDCGWRPGTQGNPQCGVLFRGGPVGSDCASFQKMQS