McDonnell Genome Institute

Washington University

CircRNA

chr5|134773695|134783065|+|DDX46|ENST00000354283.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9099

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LGPVWNFHEDLK

Amino Acids from 5' Exons

NFDQNKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEIEEMKQGKKWSLEDDD,TLTRISWKKKESEKKEKNGEKSNVKRLWKTENKRKSKRNKGKSGVRTMM,LPEAGRRNEKAKRKSRKMARRATKGYGKHRRTEKGNRRDETREKVEFRGR

Amino Acids from 3' Exons

RMCFDWKWRALQLKEKVAPNQLNPGSSVEFPRSIPSR,GKCVSIGNGGHYSRKRLPQTNILGPVWNFHEDLKFPQE,VNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLK