McDonnell Genome Institute

Washington University

CircRNA

chr5|134693726|134718173|+|SEC24A|ENST00000398844.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9293

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

DGAFLMDAGSLVQDLLK

Amino Acids from 5' Exons

LVQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSSAK,SCKIYKLCHKCLPRLWRPRVPWVLHCRLPLSCLQLVVECLSFKHNSQLLEWEPNHERNQTTGHLL,RARFTENFATNVYQDSGDPECLGSCTAGCLADVSNWWSNVCLSNTTPNSWSGSPETTRGTKPQVIC

Amino Acids from 3' Exons

GALNISDRTIPQPPILQLSVEKLSRDGAFLMDAGS,EHSTSVIEPYLSPPFFSFQWRSAEMELSSWMQA,STQHQNHTSAPHSSAFSGEAEQRWSFPHGCRL